Antibodies

Jump to Filters
View as table Download
PTDSS2 (N-term) Rabbit Polyclonal Antibody
AP53496PU-N

USD 580.00

2 Weeks

PTDSS2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human PTDSS2
PTDSS2 Rabbit Polyclonal Antibody
TA339559

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTDSS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the N terminal of human PTDSS2. Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE
PTDSS2 Rabbit Polyclonal Antibody
TA339560

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTDSS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the middle region of human PTDSS2. Synthetic peptide located within the following region: QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR