Antibodies

View as table Download

Rabbit polyclonal anti-AP-2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human AP-2.

Rabbit Polyclonal Anti-TFAP2A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS

Rabbit Polyclonal Anti-AP-2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2