Rabbit polyclonal anti-AP-2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human AP-2. |
Rabbit polyclonal anti-AP-2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human AP-2. |
Rabbit Polyclonal Anti-TFAP2A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS |
Rabbit Polyclonal Anti-AP-2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2 |