Antibodies

Jump to Filters
View as table Download
p53 (TP53) Rabbit Polyclonal Antibody
TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
p53 (TP53) Goat Polyclonal Antibody
AB0154-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA324776

USD 580.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Monkey, Rabbit)
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific
E2F3 Rabbit Polyclonal Antibody
TA349084

USD 570.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.
p53 (TP53) Goat Polyclonal Antibody
AB0065-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA326192

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).
E2F2 Rabbit Polyclonal Antibody
TA343440

USD 539.00

5 Days

Rabbit Polyclonal Anti-E2F2 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2. Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
MDM2 Rabbit Polyclonal Antibody
TA325681

USD 380.00

4 Weeks

Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166.
Modifications Phospho-specific
p53 (TP53) Rabbit Polyclonal Antibody
TA354205

USD 370.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354509

USD 395.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354572

USD 425.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein
Rb (RB1) Rabbit Polyclonal Antibody
TA314427

USD 380.00

4 Weeks

Rabbit polyclonal Retinoblastoma (Ab-608) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V).
p53 (TP53) Rabbit Polyclonal Antibody
TA342298

USD 485.00

5 Days

Rabbit Polyclonal Anti-TRP53 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR
E2F2 Rabbit Polyclonal Antibody
TA311688

USD 380.00

In Stock

Rabbit polyclonal anti-E2F2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human E2F2.