TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TARBP2 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) TARBP2 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TARBP2 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
TARBP2 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TARBP2 mouse monoclonal antibody, clone OTI7C1 (formerly 7C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal TRBP Antibody
Applications | IHC, WB |
Reactivities | Human, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 340-390 of human TRBP was used as the immunogen. |
TARBP2 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-TARBP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TARBP2 antibody: synthetic peptide directed towards the N terminal of human TARBP2. Synthetic peptide located within the following region: ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT |