Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-Caspase 9(S196) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Phospho-Caspase 9-S196 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S196 of human caspase 9. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Rabbit Polyclonal Caspase 9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
| Modifications | Phospho-specific |
Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
