Antibodies

Jump to Filters
View as table Download
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
TA805629

USD 447.00

In Stock

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
CF805629

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
TA805629S

USD 200.00

2 Days

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ENTPD6 Rabbit Polyclonal Antibody
TA308245

USD 625.00

5 Days

Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6
CANT1 (N-term) Rabbit Polyclonal Antibody
AP17919PU-N

USD 580.00

2 Weeks

CANT1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY.
ENTPD6 Rabbit Polyclonal Antibody
TA332148

USD 539.00

5 Days

Rabbit Polyclonal Anti-ENTPD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP
CANT1 Rabbit Polyclonal Antibody
TA340307

USD 539.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
CANT1 Rabbit Polyclonal Antibody
TA340308

USD 539.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
ENTPD6 Rabbit Polyclonal Antibody
TA362355

USD 539.00

5 Days

ENTPD6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENTPD6