Antibodies

View as table Download

CD40L mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

CD40L biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600027

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

CD40L (CD40LG) (C-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified

Applications FC
Reactivities Human
Conjugation Unconjugated

CD40L (CD40LG) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP

Rabbit anti CD154 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 51-69 of human CD154.