GLI2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI2 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
KIT mouse monoclonal antibody,clone OTI14B1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Mammalian |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
Applications | FC, FN |
Reactivities | Human |
Conjugation | Unconjugated |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
Applications | IF, IHC, IP, WB |
Conjugation | Unconjugated |
GLI3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC |
MYC mouse monoclonal antibody, clone OTI5E9G2 (formerly 5E9G2)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
KIT mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-BMP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP2 |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Mammalian |
Conjugation | Unconjugated |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |