Antibodies

View as table Download

Mouse Monoclonal Caspase-3 (Pro and Active) Antibody (31A1067)

Applications CyTOF-ready, Electron Microscopy, FC, ICC/IF, IHC, Immunoblotting, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

ICAM1 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CASP3 mouse monoclonal antibody,clone OTI3A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI3A11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI7B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated