Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 10 of 10 results

(reset)

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

TA504360

USD 478.00

In Stock

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

CF504360

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

TA504360S

USD 200.00

2 Days

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BCAT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F5]

TA504360AM

USD 509.00

2 Weeks

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F5]

TA504360BM

USD 509.00

2 Weeks

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Dog, Mouse
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

BCAT1 Rabbit Polyclonal Antibody

TA349704

USD 380.00

In Stock

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human BCAT1

1 / 3

2 / 3

3 / 3

Previous Next

BCAT1 (Center) Rabbit Polyclonal Antibody

AP50350PU-N

USD 580.00

2 Weeks

BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1

1 / 2

2 / 2

Previous Next

BCAT1 Mouse Monoclonal Antibody [Clone ID: AT3C8]

AM50619PU-N

USD 430.00

3 Weeks

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated

BCAT1 Mouse Monoclonal Antibody [Clone ID: AT3C8]

AM50619PU-S

USD 315.00

3 Weeks

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated

BCAT1 Rabbit Polyclonal Antibody

TA339285

USD 539.00

5 Days

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

1 - 10 of 10 results