Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 447.00
In Stock
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
USD 600.00
3 Days
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
USD 509.00
2 Weeks
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-TRPM5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Families
- Druggable Genome
Pathways
- Taste transduction