Antibodies

View as table Download

Goat polyclonal anti-Artemis antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C).

Artemis (DCLRE1C) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 28~58 amino acids from the N-terminal region of Human DCLRE1C.

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER