NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
NEU1 mouse monoclonal antibody,clone 3D4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
NEU1 mouse monoclonal antibody,clone 3D4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NEU1 mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
NEU1 mouse monoclonal antibody,clone 3B3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
NEU1 mouse monoclonal antibody,clone 3B3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-NEU1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
In Stock
NEU1 mouse monoclonal antibody,clone 3H2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NEU1 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |