Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against SERPINE1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1. |
Rabbit Polyclonal Serpin E1/PAI-1 Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121] |
Rabbit polyclonal SERPINE1 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
PAI1 (SERPINE1) mouse monoclonal antibody, clone MA-55F4C12, Purified
| Applications | ELISA, FN |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SERPINE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM |
PAI1 (SERPINE1) mouse monoclonal antibody, clone MA-33H1F7, Liquid
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SERPINE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ |
PAI1 (SERPINE1) mouse monoclonal antibody, clone 3E529, Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAI1 (SERPINE1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human PAI-1 |
PAI1 (SERPINE1) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified human PAI-1 |
PAI1 (SERPINE1) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified human PAI-1 |
PAI1 (SERPINE1) goat polyclonal antibody, Serum
| Applications | ELISA, IHC, R |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified Human PAI-1 |
PAI1 (SERPINE1) goat polyclonal antibody, Serum
| Applications | ELISA, IHC, R |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified Human PAI-1 |
Active filters
Target Symbol
- PAI1
Reactivities
- Human
Families
- Druggable Genome
Pathways
- Complement and coagulation cascades