Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
PGP9.5 (UCHL1) Rabbit Polyclonal Antibody
TA301477

USD 550.00

In Stock

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]
VRL1 (TRPV2) Rabbit Polyclonal Antibody
TA317464

USD 515.00

2 Weeks

TRPV2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Pig, Horse (Predicted: Bovine, Hamster, Rabbit)
Conjugation Unconjugated
Immunogen VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%).
NPFF1 Receptor (NPFFR1) Rabbit Polyclonal Antibody
TA317553

USD 515.00

2 Weeks

NPFF1 / NPFFR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen NPFFR1 / GPR147 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human NPFF1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Dog, Panda (95%); Elephant, Turkey, Chicken (85%); Opossum, Platypus (80%).
Muscarinic Acetylcholine Receptor M3 (CHRM3) Rabbit Polyclonal Antibody
TA316627

USD 515.00

In Stock

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig)
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).
HCAR1 Rabbit Polyclonal Antibody
TA316878

USD 515.00

5 Days

FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Rabbit, Rat, Hamster (Predicted: Mouse, Horse, Pig)
Conjugation Unconjugated
Immunogen FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%).
Cannabinoid Receptor II (CNR2) Rabbit Polyclonal Antibody
TA317640

USD 515.00

5 Days

CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Horse)
Conjugation Unconjugated
Immunogen CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%).
ADAMTS1 Rabbit Polyclonal Antibody
TA317919

USD 515.00

In Stock

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan (Predicted: Bat, Bovine, Xenopus)
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%).
TNIK Rabbit Polyclonal Antibody
TA317446

USD 515.00

5 Days

TNIK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Xenopus)
Conjugation Unconjugated
Immunogen TNIK antibody was raised against synthetic 18 amino acid peptide from internal region of human TNIK. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Lizard (100%); Xenopus (94%).
GPR183 Rabbit Polyclonal Antibody
TA316825

USD 515.00

2 Weeks

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human (Predicted: Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).
Vasopressin V1b receptor (AVPR1B) Rabbit Polyclonal Antibody
TA317556

USD 515.00

5 Days

AVPR1B Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Pig, Rabbit, Rat, Gibbon, Horse (Predicted: Monkey, Mouse)
Conjugation Unconjugated
Immunogen AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%).
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA317617

USD 515.00

5 Days

GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Human (Predicted: Monkey, Mouse, Rat, Dog, Horse)
Conjugation Unconjugated
Immunogen GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%).
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316586

USD 515.00

2 Weeks

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).
STAT2 Rabbit Polyclonal Antibody
TA319247

USD 765.00

In Stock

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.
RHOC Rabbit Polyclonal Antibody
TA333447

USD 539.00

5 Days

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF