Antibodies

Jump to Filters
View as table Download
Wilms Tumor Protein (WT1) Rabbit Monoclonal Antibody [Clone ID: OTIR5F11]
TA591047S

USD 224.00

In Stock

Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Wilms Tumor Protein (WT1) (Center) Rabbit Polyclonal Antibody
AP54572PU-N

USD 580.00

2 Weeks

Wilms Tumor Protein (WT1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 353-383 (E361) amino acids from the Central region of human WT1
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335174

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA326990

USD 365.00

3 Weeks

WT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA308577

USD 625.00

2 Weeks

Rabbit polyclonal antibody to WT1 (Wilms tumor 1)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544)
Wilms Tumor Protein (WT1) Mouse Monoclonal Antibody [Clone ID: 6F-H2]
TA327754

USD 695.00

5 Days

Mouse Monoclonal WT1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
TA327754 is a replacement of AM00403SU-L.
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA329197

USD 539.00

5 Days

Rabbit Polyclonal anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WT1 antibody is: synthetic peptide directed towards the N-terminal region of Human WT1. Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC
Wilms Tumor Protein (WT1) Goat Polyclonal Antibody
TA302633

USD 520.00

5 Days

Goat Polyclonal Antibody against Wilms tumor 1 / WT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QDPASTCVPEPASQH, from the N Terminus of the protein sequence according to NP_000369.3; NP_077742.2; NP_077743.2; NP_077744.3.
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335173

USD 539.00

5 Days

Rabbit Polyclonal Anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the N terminal of human WT1. Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA