Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody

CAT#: TA335174

Rabbit Polyclonal Anti-WT1 Antibody

Product Images

WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

• 

  Human Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: Wilms tumor 1
• Database Link:
  NP_077742
  Entrez Gene 22431 MouseEntrez Gene 7490 Human
  UniProt ID P19544
• Background: This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation site upstream of and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq, Oct 2010]
• Synonyms: AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors