Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
TAP1 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAP1 peptide corresponding to the C-terminal of the human protein conjugated to KLH. |
Goat Anti-TAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKFREKLQEIKT, from the internal region of the protein sequence according to NP_000584.2. |
TAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAP1 |
TAP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 524-808 of human TAP1 (NP_000584.2). |
| Modifications | Unmodified |
TAP1 rabbit polyclonal antibody, Ig Fraction
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Transporter Associated Protein (TAP I) peptide corresponding to the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Germany
Japan
United Kingdom
China
