Rabbit polyclonal antibody to NSMCE1 (non-SMC element 1 homolog (S. cerevisiae))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of NSMCE1 (Uniprot ID#Q8WV22) |
Rabbit Polyclonal Anti-NSMCE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSMCE1 antibody: synthetic peptide directed towards the middle region of human NSMCE1. Synthetic peptide located within the following region: KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN |
Rabbit Polyclonal Anti-NSMCE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSMCE1 antibody: synthetic peptide directed towards the N terminal of human NSMCE1. Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL |
NSMCE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 7-266 of human NSMCE1 (NP_659547.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
