Germany
Japan
United Kingdom
China
MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF |
Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: QENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPICY |
Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the N terminal of human MAGEA9. Synthetic peptide located within the following region: RSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSS |
MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- MAGEA9
Conjugates
- Unconjugated