Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FOLR2 mouse monoclonal antibody, clone OTI8G1 (formerly 8G1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOLR2 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOLR2 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOLR2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 16-44 amino acids from the N-terminal region of Human Folate receptor beta |
Rabbit Polyclonal Anti-FOLR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOLR2 antibody is: synthetic peptide directed towards the C-terminal region of Human FOLR2. Synthetic peptide located within the following region: LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA |
Recombinant Anti-Folate receptor beta (Clone CL10)
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Anti-FOLR2 antibody(DMC390), IgG1 Chimeric mAb
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FOLR2
Conjugates
- Unconjugated