Antibodies

Jump to Filters
View as table Download
ZNF289 (ARFGAP2) Rabbit Polyclonal Antibody
TA351972

USD 380.00

In Stock

Anti-ARFGAP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARFGAP2
ZNF289 (ARFGAP2) Rabbit Polyclonal Antibody
TA337266

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARFGAP29 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF289 antibody: synthetic peptide directed towards the N terminal of human ZNF289. Synthetic peptide located within the following region: YREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPA
ZNF289 (ARFGAP2) Rabbit Polyclonal Antibody
TA345441

USD 539.00

5 Days

Rabbit Polyclonal Anti-ARFGAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARFGAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human ARFGAP2. Synthetic peptide located within the following region: AAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSG