Antibodies

Jump to Filters
View as table Download
Collagen VI (COL6A3) Rabbit Polyclonal Antibody
TA313660

USD 380.00

4 Weeks

Rabbit polyclonal Collagen VI a3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a3.
Collagen VI (COL6A1) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
CF812064

USD 564.00

4 Weeks

Carrier-free (BSA/glycerol-free) COL6A1 mouse monoclonal antibody,clone OTI1G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Collagen VI (COL6A2) Rabbit Polyclonal Antibody
TA313659

USD 380.00

In Stock

Rabbit polyclonal Collagen VI a2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a2.
Collagen VI (COL6A1) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
TA812064S

USD 188.00

2 Days

COL6A1 mouse monoclonal antibody,clone OTI1G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Collagen VI (COL6A1) Rabbit Polyclonal Antibody
R1043

USD 780.00

3 Days

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Unconjugated
Immunogen Collagen type VI purified from Human and Bovine placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
BP8033S

USD 730.00

2 Weeks

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine, Chicken, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified collagen type VI from human placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
R1043X

USD 1,420.00

3 Days

Collagen VI (COL6A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Unconjugated
Immunogen Collagen type VI purified from Human and Bovine placenta.
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
TA338915

USD 539.00

5 Days

Rabbit Polyclonal Anti-COL6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Collagen VI (COL6A2) (C-term) Rabbit Polyclonal Antibody
AP51018PU-N

USD 580.00

2 Weeks

Collagen VI (COL6A2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 719-747 amino acids from the C-terminal region of human COL6A2
Collagen VI (COL6A1) alpha 1 chain Rabbit Polyclonal Antibody
AP17225PU-N

USD 580.00

2 Weeks

Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human COL6A1
Collagen VI (COL6A1) alpha 1 chain Rabbit Polyclonal Antibody
AP17226PU-N

USD 580.00

2 Weeks

Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human COL6A1
Collagen VI (COL6A2) Rabbit Polyclonal Antibody
TA338916

USD 485.00

5 Days

Rabbit Polyclonal Anti-COL6A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL6A2 antibody: synthetic peptide directed towards the C terminal of human COL6A2. Synthetic peptide located within the following region: ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI