KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against KITLG (C-term)
Applications | FC, IF, WB |
Reactivities | Human (Predicted: Bovine, Pig) |
Conjugation | Unconjugated |
Immunogen | This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG). |
Rabbit Polyclonal SCF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF. |
KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) recombinant hSCF. |
Rabbit Polyclonal Anti-KITLG Antibody
Applications | WB |
Reactivities | Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
SCF (KITLG) mouse monoclonal antibody, Azide Free
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SCF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF. |