Antibodies

Jump to Filters
View as table Download
TAT Rabbit Polyclonal Antibody
TA323688

USD 380.00

2 Weeks

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase
COQ2 Rabbit Polyclonal Antibody
TA341982

USD 539.00

5 Days

Rabbit Polyclonal Anti-COQ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
TAT Rabbit Polyclonal Antibody
TA590802

USD 482.00

In Stock

Rabbit Polyclonal TAT Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
COQ6 Rabbit Polyclonal Antibody
TA337726

USD 539.00

5 Days

Rabbit Polyclonal Anti-COQ6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COQ6 antibody is: synthetic peptide directed towards the N-terminal region of Human COQ6. Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA
HPD Rabbit Polyclonal Antibody
TA346087

USD 539.00

5 Days

Rabbit Polyclonal Anti-HPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV