Antibodies

View as table Download

Rabbit Polyclonal Anti-DACH2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DACH2

Rabbit Polyclonal Anti-DACH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DACH2 antibody is: synthetic peptide directed towards the C-terminal region of Human DACH2. Synthetic peptide located within the following region: QALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQ

Rabbit Polyclonal Anti-DACH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DACH2 antibody: synthetic peptide directed towards the C terminal of human DACH2. Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG