Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Profilin 1 Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human protein (within residues 100-140). [Swiss-Prot# P07737] |
Rabbit Polyclonal Anti-PFN1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL |
Anti-PFN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1 |
Rabbit Polyclonal Anti-PFN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFN1 |
PFN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PFN1 |