USD 447.00
In Stock
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Weeks
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 200.00
2 Days
KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 200.00
2 Days
Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 200.00
2 Days
KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719) |
Rabbit Polyclonal Anti-KYNU Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP |
L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU |
Rabbit Polyclonal Anti-KYNU Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK |