Antibodies

Jump to Filters
View as table Download
CLCN1 Rabbit Polyclonal Antibody
TA338391

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-Clcn1 Antibody

Applications WB
Reactivities Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV
CLCN1 Rabbit Polyclonal Antibody
TA332875

USD 365.00

3 Weeks

Rabbit anti-CLCN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLCN1