Antibodies

Jump to Filters
View as table Download
P2X7 (P2RX7) Rabbit Polyclonal Antibody
TA349115

USD 570.00

5 Days

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen P2RX7 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human P2RX7.
P2RX7 Goat Polyclonal Antibody
TA305642

USD 520.00

5 Days

Goat Anti-P2RX7 / P2X7 receptor Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2.
P2RX7 Rabbit Polyclonal Antibody
TA338533

USD 539.00

5 Days

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP
P2RX7 Rabbit Polyclonal Antibody
TA338780

USD 539.00

5 Days

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP