Antibodies

View as table Download

MIF (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human MIF

Goat Polyclonal Antibody against MIF

Applications WB
Reactivities Human (Expected from sequence similarity: Rat, Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAANVGWNNSTFA, from the C Terminus of the protein sequence according to NP_002406.1.

Rabbit anti-MIF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MIF

Chicken polyclonal anti-MIF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgY fraction antibody was prepared from eggs of chickens laid after repeated immunizations with a synthetic peptide corresponding to aa 2-32 of Human MIF conjugated to keyhole limpet hemocyanin (KLH). MIF is a proinflammatory cytokine that plays an important role in systemic inflammatory events.

Rabbit Polyclonal Anti-MIF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL