Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal ALOX12 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALOX12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 618-650 amino acids from the C-terminal region of human ALOX12. |
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ALOX12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- 12 LIPOXYGENASE
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Arachidonic acid metabolism