Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Vegfc rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Rat VEGF-C native protein.(Asp101-Ile221) derived from insect cells (Cat.-No DA3519X) |
Vegfc rabbit polyclonal antibody, Biotin
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Recombinant Rat VEGF-C native protein (Asp101-Ile221) derived from insect cells (Cat.-No DA3519X) |
Vegfc rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Rat VEGF-C native protein.(Asp101-Ile221) derived from insect cells (Cat.-No DA3519X) |
VEGFC Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VEGFC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |
VEGFC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human VEGFC |
Active filters
Target Symbol
- VEGFC
Clonalities
- Polyclonal