Antibodies

Jump to Filters
View as table Download
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
AP02094SU-N

USD 765.00

2 Weeks

Transglutaminase 3 (TGM3) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant Human epidermal Transglutaminase [TGe]
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
AP02094SU-S

USD 230.00

2 Weeks

Transglutaminase 3 (TGM3) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant Human epidermal Transglutaminase [TGe]
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
TA332965

USD 365.00

3 Weeks

Rabbit anti-TGM3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TGM3
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
TA346349

USD 539.00

5 Days

Rabbit Polyclonal Anti-TGM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGM3 antibody: synthetic peptide directed towards the N terminal of human TGM3. Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
Transglutaminase 3 (TGM3) Goat Polyclonal Antibody
TA309514

USD 520.00

5 Days

Goat Polyclonal Antibody against Transglutaminase 3 (aa598-610)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLEVLNEARVRKP, from the internal region of the protein sequence according to NP_003236.3.
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
TA360231

USD 539.00

5 Days

TGM3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGM3