Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against NNMT (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-106 amino acids from the Central region of human NNMT. |
Rabbit Polyclonal Anti-NNMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
Goat Anti-NNMT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TSKDTYLSHFNP-C, from the N Terminus of the protein sequence according to NP_006160.1. |
NNMT Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
| Modifications | Unmodified |
NNMT Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
| Modifications | Unmodified |
Goat Anti-NNMT (aa171-182) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PDLPTYCRALRN, from the internal region of the protein sequence according to NP_006160.1. |
Active filters
Target Symbol
- NNMT
Clonalities
- Polyclonal