NNMT Rabbit Polyclonal Antibody

CAT#: TA346428

Rabbit Polyclonal Anti-NNMT Antibody

Product Images

WB Suggested Anti-NNMT Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  WB Suggested Anti-NNMT Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: nicotinamide N-methyltransferase
• Database Link:
  NP_006160
  Entrez Gene 4837 Human
  UniProt ID P40261
• Background: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.
• Synonyms: nicotinamide N-methyltransferase
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 86%

Reference Data

• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism