Antibodies

Jump to Filters
View as table Download
PSMB10 Rabbit Polyclonal Antibody
TA365998

USD 380.00

4 Weeks

PSMB10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB10
PSMB10 Goat Polyclonal Antibody
TA305923

USD 520.00

5 Days

Goat Anti-MECL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PTEPVKRSGRYH, from the internal region of the protein sequence according to NP_002792.1.
PSMB10 Rabbit Polyclonal Antibody
TA380451

USD 365.00

3 Weeks

PSMB10 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (NP_002792.1).
Modifications Unmodified
PSMB10 Rabbit Polyclonal Antibody
TA370349

USD 380.00

4 Weeks

PSMB10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB10
PSMB10 (C-term) Rabbit Polyclonal Antibody
AP53486PU-N

USD 580.00

2 Weeks

PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10
PSMB10 Rabbit Polyclonal Antibody
TA342171

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG