Rabbit Polyclonal Lipase A Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571] |
Rabbit Polyclonal Anti-LIPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD |
Germany
Japan
United Kingdom
China
