Rabbit Polyclonal Anti-GNA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNA13 |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNA13 |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI |
GNA13 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GNA13 |