Rabbit Polyclonal Anti-CBFA2T3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBFA2T3 antibody: synthetic peptide directed towards the N terminal of human CBFA2T3. Synthetic peptide located within the following region: QPRSTPPSMPPPPPAASQGATRPPSFTPHTLMNGSSHSPTAINGAPCTPN |
Rabbit polyclonal anti-MTG16 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MTG16. |
Rabbit Polyclonal Anti-CBFA2T3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBFA2T3 antibody: synthetic peptide directed towards the N terminal of human CBFA2T3. Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP |
CBFA2T3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 305-390 of human CBFA2T3 (NP_005178.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
