Antibodies

Jump to Filters
View as table Download
ASS1 Rabbit Polyclonal Antibody
TA308171

USD 625.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)
ASS1 Rabbit Polyclonal Antibody
TA346025

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
ASS1 Rabbit Polyclonal Antibody
TA346024

USD 485.00

5 Days

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
ASS1 Goat Polyclonal Antibody
TA302415

USD 520.00

In Stock

Goat Polyclonal Antibody against Argininosuccinate synthetase 1

Applications WB
Reactivities Human, Cow (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1.
ASS1 Rabbit Polyclonal Antibody
TA307900

USD 625.00

5 Days

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 155 and 412 of ASS1 (Uniprot ID#P00966)