Antibodies

Jump to Filters
View as table Download
TRADD Rabbit Polyclonal Antibody
TA312115

USD 380.00

In Stock

Rabbit polyclonal anti-TRADD antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TRADD.
TRADD Rabbit Polyclonal Antibody
TA330326

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRADD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRADD antibody: synthetic peptide directed towards the middle region of human TRADD. Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL
TRADD Rabbit Polyclonal Antibody
TA347499

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TRADD Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRADD Antibody: A synthesized peptide derived from human TRADD
TRADD Rabbit Polyclonal Antibody
TA326949

USD 365.00

3 Weeks

Rabbit anti-TRADD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TRADD