Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to HSD3a (aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 217 of HSD3a (Uniprot ID#P17516) |
USD 625.00
5 Days
Rabbit Polyclonal antibody to HSD17B4 (hydroxysteroid (17-beta) dehydrogenase 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 355 and 645 of HSD17B4 (Uniprot ID#P51659) |
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit polyclonal Anti-SCP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
Rabbit Polyclonal Anti-AMACR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Rabbit Polyclonal Anti-CYP46A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM |
Rabbit polyclonal Cytochrome P450 7B1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-CYP39A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1. |
Rabbit Polyclonal Anti-CH25H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CH25H antibody is: synthetic peptide directed towards the C-terminal region of Human CH25H. Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH |
Goat Polyclonal Antibody against AKR1C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DPKYQRVELNDGH-C, from the N Terminus of the protein sequence according to NP_001809.2. |
Active filters
Reactivities
- Human
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Primary bile acid biosynthesis