Antibodies

Jump to Filters
View as table Download
FOXO3 (221-270) Rabbit Polyclonal Antibody
AP20683PU-N

USD 465.00

3 Weeks

FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA332108

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
p53 (TP53) Rabbit Polyclonal Antibody
TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA312331

USD 380.00

In Stock

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.
p53 (TP53) Rabbit Polyclonal Antibody
TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA334734

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
FOXO3 (661-673) Goat Polyclonal Antibody
AP23030PU-N

USD 500.00

2 Weeks

FOXO3 (661-673) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide from C Terminus of human FKHRL1 / FOXO3A
FOXO3 Rabbit Polyclonal Antibody
TA321350

USD 380.00

In Stock

Anti-FOXO3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 442-454 amino acids of Human forkhead box O3
p53 (TP53) Rabbit Polyclonal Antibody
TA329141

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
E2F1 Rabbit Polyclonal Antibody
TA590609

USD 482.00

In Stock

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
p53 (TP53) Goat Polyclonal Antibody
AB0154-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
Retinoic Acid Receptor beta (RARB) Rabbit Polyclonal Antibody
TA312377

USD 380.00

In Stock

Rabbit polyclonal Retinoic Acid Receptor beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β.
FOXO3 pSer253 Rabbit Polyclonal Antibody
AP20805PU-N

USD 495.00

3 Weeks

FOXO3 pSer253 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
p53 (TP53) Rabbit Polyclonal Antibody
TA302001

USD 580.00

5 Days

Rabbit Polyclonal Antibody against TP53 (T55)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53.