Antibodies

View as table Download

Anti-ADAM15 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 213-414 amino acids of human ADAM metallopeptidase domain 15

Anti-ADAM15 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 213-414 amino acids of human ADAM metallopeptidase domain 15

Rabbit Polyclonal Anti-ADAM15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ