Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF |
Anti-PPARA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
TA321679 is a possible alternative to TA321680.
Goat Polyclonal Antibody against RXRA
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Anti-PPARA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha |
PPARG Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | N term -peptide of human PPARG |
Rabbit Polyclonal PPAR-gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-gamma |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
PPAR alpha (PPARA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against PPAR delta (Isoform 1)
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1. |
Goat Polyclonal Antibody against RXR beta
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811. |
Rabbit anti-PPARG polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein |
Rabbit Polyclonal Phospho-PPAR- gamma (Ser112) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR- gamma around the phosphorylation site of Serine 112 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Nuclear Hormone Receptor
Pathways
- PPAR signaling pathway