Antibodies

Jump to Filters
View as table Download
FGF18 Rabbit Polyclonal Antibody
TA349977

USD 380.00

In Stock

Rabbit Polyclonal Anti-FGF18 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGF18
FGF18 Rabbit Polyclonal Antibody
TA314813

USD 380.00

2 Weeks

Rabbit polyclonal anti-FGF18 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGF18.
FGF18 (N-term) Rabbit Polyclonal Antibody
AP17367PU-N

USD 580.00

2 Weeks

FGF18 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human FGF18
FGF18 Rabbit Polyclonal Antibody
TA343340

USD 539.00

5 Days

Rabbit Polyclonal Anti-FGF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF18 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF18. Synthetic peptide located within the following region: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE