Antibodies

Jump to Filters
View as table Download
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316586

USD 515.00

2 Weeks

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).
UCP2 Goat Polyclonal Antibody
TA318227

USD 555.00

2 Weeks

UCP2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Zebrafish)
Conjugation Unconjugated
Immunogen UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%).
STAT2 Rabbit Polyclonal Antibody
TA319247

USD 765.00

In Stock

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.
RHOC Rabbit Polyclonal Antibody
TA333447

USD 539.00

5 Days

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
ROR gamma (RORC) Rabbit Polyclonal Antibody
TA340510

USD 515.00

5 Days

Rabbit Polyclonal Anti-RORC Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human (Predicted: Bovine, Horse, Rabbit)
Conjugation Unconjugated
Immunogen RORC / ROR Gamma antibody was raised against synthetic 18 amino acid peptide from ligand-binding domain of human ROR Gamma. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Tamarin, Elephant, Bat (100%); Bovine, Rabbit, Horse (94%); Mouse, Rat, Hamster, Panda (89%); Dog (83%).
ADGRB3
TA340548

USD 515.00

5 Days

BAI3 (C-Terminus) rabbit polyclonal antibody, Immunoaffinity purified

Applications IHC
Reactivities Human, Chicken, Bovine, Rabbit, Mouse, Dog, Rat, Horse, Bat, Monkey
Conjugation Unconjugated
Immunogen Synthetic 19 amino acid peptide from C-Terminus of human BAI3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Horse, Rabbit, Opossum, Chicken (100%); Elephant, Panda (95%); Lizard (89%).
Ankyrin G (ANK3) Goat Polyclonal Antibody
TA316531

USD 500.00

In Stock

ANK3 / ANKYRIN-G Goat Polyclonal Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Pig (Predicted: Bovine, Dog, Horse)
Conjugation Unconjugated
Immunogen ANK3 / ANKYRIN-G antibody was raised against synthetic peptide C-SWQNETSSGNLE from an internal region of human ANK3 (NP_066267.2; NP_001140.2). Percent identity by BLAST analysis: Human, Gorilla, Monkey, Pig (100%); Orangutan, Gibbon, Elephant, Panda, Bovine, Dog, Horse (92%); Hamster, Bat, Rabbit (83%).
GPR55 Rabbit Polyclonal Antibody
TA316838

USD 515.00

5 Days

GPR55 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human (Predicted: Monkey, Bovine, Dog, Hamster, Horse)
Conjugation Unconjugated
Immunogen GPR55 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human GPR55. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Hamster, Bovine, Dog, Horse (94%); Elephant, Panda, Bat (88%); Rabbit (82%).
OXGR1 Rabbit Polyclonal Antibody
TA317121

USD 515.00

5 Days

GPR80 / OXGR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey (Predicted: Bat, Dog, Horse)
Conjugation Unconjugated
Immunogen GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Dog, Bat, Elephant, Panda, Horse (94%); Mouse, Rat, Bovine (88%); Rabbit (81%).
TAS1R1 Rabbit Polyclonal Antibody
TA317408

USD 515.00

5 Days

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Gorilla, Human, Pig, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster, Rabbit)
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit
GPRC6A Rabbit Polyclonal Antibody
TA317596

USD 515.00

5 Days

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey (Predicted: Dog, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Panda (100%); Dog, Elephant, Rabbit, Horse, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster (82%).
Metabotropic Glutamate Receptor 2 (GRM2) Rabbit Polyclonal Antibody
TA317616

USD 515.00

5 Days

MGLUR2 / GLUR2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster (Predicted: Monkey, Horse)
Conjugation Unconjugated
Immunogen GRM2 / MGLUR2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM2 / MGLUR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Pig (100%); Chimpanzee, Monkey, Horse, Platypus (95%).
CD26 (DPP4) Rabbit Polyclonal Antibody
TA341337

USD 515.00

In Stock

Rabbit Polyclonal Anti-DPP4 Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey, Horse)
Conjugation Unconjugated
Immunogen DPP4 / CD26 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human CD26. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey (100%); Orangutan, Galago, Marmoset, Horse (94%); Elephant, Dog, Pig (89%); Panda, Cat (83%).
GLG1 Rabbit Polyclonal Antibody
TA316782

USD 515.00

5 Days

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Zebrafish, Gibbon, Hamster, Horse
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%).
Integrin alpha 3 (ITGA3) Rabbit Polyclonal Antibody
TA316934

USD 515.00

5 Days

ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human (Predicted: Monkey, Mouse, Bat, Dog, Hamster, Horse)
Conjugation Unconjugated
Immunogen ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%).