Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-DNMT3B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3B |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-DNMT1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1 |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
DNMT3A Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3A |
DNMT3B Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DNMT3B |
Rabbit Polyclonal Anti-MPST Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST. Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT |
Goat Polyclonal Antibody against DNMT1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Cysteine and methionine metabolism