Antibodies

Jump to Filters
View as table Download
PDGF AA (PDGFA) Rabbit Polyclonal Antibody
TA322986

USD 380.00

4 Weeks

Anti-PDGFA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide
PDGF AA (PDGFA) Rabbit Polyclonal Antibody
TA322985

USD 380.00

4 Weeks

Anti-PDGFA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide
PDGF AA (PDGFA) Rabbit Polyclonal Antibody
TA343338

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
PDGF AA (PDGFA) Rabbit Polyclonal Antibody
TA347904

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA Antibody: A synthesized peptide